# Buy Cagrilintide 10 mg in Australia

Supplied by Australian Research Peptides Pty Ltd to laboratories and
researchers in Australia, for in vitro research purposes only. Stock is
held and dispatched within Australia.

Australian Research Peptides lists Cagrilintide 10 mg for laboratories and researchers across Australia, one freeze-dried vial costing $189.99, though it is out of stock for now. Cagrilintide is a 37-amino-acid version of amylin, a pancreatic hormone. It differs from human amylin at six points, with a 20-carbon fatty chain at the front. It is listed as PubChem CID 171397054 and UNII AO43BIF1U8. A reference material for glassware and cell-culture work, it is tested by an independent laboratory hired by the manufacturer. In vitro research purposes only.

Research context: amylin receptor research.

## Strengths, prices and availability

| Strength | Price (AUD) | Availability | SKU |
| --- | --- | --- | --- |
| 10 mg | $189.99 | Out of stock | 67540 |

## Specifications

| Property | Value |
| --- | --- |
| Scientific name | Cagrilintide (INN); UNII AO43BIF1U8 |
| Compound class | Lipidated 37-amino-acid amylin analogue |
| Sequence | KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2, cyclic Cys2-Cys7 disulfide, N-terminally acylated with a C20 diacid through a gamma-glutamate spacer |
| Appearance | White to off-white lyophilised (freeze-dried) powder |
| Packaging | Sealed, tamper-evident glass vial |
| Storage | Freeze-dried powder kept tightly closed below -15 °C, colder for long-term holding; brought to room temperature in a desiccator before opening |

## About

Cagrilintide belongs to the amylin analogue family, which means it is built on the structure of amylin. Amylin, also known as islet amyloid polypeptide, is a 37-amino-acid hormone made in the pancreas. UniProt describes it as glucoregulatory, meaning it is involved in blood-sugar control, and records that it signals through receptors made from a calcitonin receptor plus helper proteins called receptor activity-modifying proteins. The FDA substance registry files cagrilintide under that same heading, as an amylin analogue.

Cagrilintide differs from human amylin at six positions, and four of those six swap in a proline where the natural hormone has a different amino acid. Kruse and colleagues published the design work in 2021. They named amylin's strong tendency to clump into amyloid fibrils as the problem the molecule was designed around, and described what they made as a stable, lipidated, long-acting amylin analogue. Lipidated means a fatty chain is attached, in this case a twenty-carbon chain joined to the front of the peptide through a glutamate linker. A sulfur-to-sulfur bond closes a small loop between the second and seventh amino acids.

Australian Research Peptides lists cagrilintide under Metabolic Research as a single 10 mg vial, sealed in tamper-evident glass and posted from within Australia to laboratories and researchers, not sent from an overseas warehouse. People search for it as cagrilintide, cagri and cagrilintide acetate. It is tested by an independent laboratory hired by the manufacturer, and the CoA library shows which products have a published certificate. The vial is a reference compound for laboratory work, and it is not an approved therapeutic good in this country.

## Questions

### Where to buy Cagrilintide 10mg in Australia?

Cagrilintide 10mg is listed in Australia by Australian Research Peptides, which serves laboratories and researchers nationwide, as a 10 mg vial at A$189.99, out of stock for now. It comes in that one strength, freeze-dried, under Metabolic Research, and is sent by tracked post to every state and territory, so nothing has to clear customs on the way in. You can pay by PayID or bank transfer; wallets, buy-now-pay-later instalments and crypto are not accepted.

### What is Cagrilintide?

Cagrilintide is a synthetic peptide made of 37 amino acids, modelled on amylin, a hormone made in the pancreas, with a twenty-carbon fatty chain attached at the front. Amylin is also known as islet amyloid polypeptide. The FDA substance registry classes cagrilintide as an amylin analogue, meaning a molecule built on amylin's structure, and [PubChem](https://pubchem.ncbi.nlm.nih.gov/compound/171397054) lists it as CID 171397054 under the generic name cagrilintide. Australian Research Peptides sells the freeze-dried powder to laboratories and researchers.

### What class of peptide is cagrilintide?

Cagrilintide belongs to the amylin analogue class, meaning it is built on the structure of amylin, a hormone from the pancreas, rather than on GLP-1, a hormone from the gut. UniProt describes amylin as signalling through receptors, the docking points on a cell, made from a calcitonin receptor and helper proteins called receptor activity-modifying proteins. That receptor family is what sets this product apart from the GLP-1 products listed beside it. The class describes what a molecule is built from, not what it does in a subject.

### Is cagrilintide a GLP-1 peptide?

No, cagrilintide is an amylin analogue rather than a GLP-1 peptide, and the difference is which hormone each one copies: amylin comes from cells in the pancreas, while GLP-1 is released from the gut. The two have separate registry records, and PubChem lists cagrilintide as CID 171397054 under its own generic name. Australian Research Peptides places cagrilintide under Metabolic Research alongside its GLP-1 products, which is a shop category, not a claim that one can stand in for the other.

### What is amylin, and what does cagrilintide have to do with it?

Amylin is the 37-amino-acid hormone that cagrilintide is modelled on, made in the pancreas and listed by [UniProt](https://www.uniprot.org/uniprotkb/P10997/entry) under accession P10997 as islet amyloid polypeptide. The finished hormone is cut from positions 34 to 70 of a longer 89-amino-acid chain, has a small ring between its second and seventh amino acids held by a sulfur-to-sulfur link, and ends in a tyrosine amide. Cagrilintide keeps the same length and the same ring, but changes six positions.

### Why is cagrilintide described as long-acting?

Cagrilintide is called long-acting because of lipidation, meaning a fatty chain is attached to the peptide, and the [2021 design paper by Kruse and colleagues](https://pubmed.ncbi.nlm.nih.gov/34288673/) describes it as a stable, lipidated, long-acting amylin analogue. Those are the paper's own words about the chemistry, not a claim Australian Research Peptides makes about what is in a vial. PubChem and the FDA substance registry list it under the same generic name.

### Is cagrilintide the same as pramlintide?

No, cagrilintide and pramlintide are two different molecules built on amylin, and the easiest way to tell them apart is the fatty chain: cagrilintide has a twenty-carbon one at the front and pramlintide has none. PubChem lists pramlintide at CID 70691388 with the formula C171H267N51O53S2, and cagrilintide at CID 171397054 with the formula C194H312N54O59S2. Both are 37 amino acids long. Australian Research Peptides sells cagrilintide only.

### What receptors does the amylin family act at?

Amylin receptors, the family cagrilintide is built around, are made of more than one protein: UniProt describes them as a calcitonin receptor joined to helper proteins called receptor activity-modifying proteins, shortened to AMYR. A receptor is the docking point a hormone fits into. The same record notes that amylin can bind the calcitonin receptor on its own, but is more selective for the assembled form. Australian Research Peptides claims nothing beyond that published science.

### What else is cagrilintide known as?

Cagrilintide is the official generic name, known as the international non-proprietary name, and the same substance is also listed under the developer code NN0174-0833, as PubChem CID 171397054, and as UNII AO43BIF1U8 in the FDA substance registry. The design paper that introduced it calls it analogue 23, and buyers often shorten it to cagri when searching. All of these names point to the same compound, and Australian Research Peptides links every one of them to the single 10 mg listing.

### What does cagri mean when people search for it?

Cagri is simply a short form of cagrilintide that people type into search boxes, the same way retatrutide often gets shortened to reta. It is not a different product, and no registry recognises the abbreviation. Australian Research Peptides has set up cagri as a search alias so it brings up this page, which lists the single 10 mg vial described here.

### Is cagrilintide acetate the same as cagrilintide?

Cagrilintide acetate is the same peptide supplied as an acetate salt, so the order of amino acids is identical and the only difference is the partner ion paired with it. That difference matters for calculations, because a salt changes the formula, the weight and the registry number. That is why Australian Research Peptides shows the sequence in the specification panel, and gives the mass and CAS figures in a separate answer that says which form they describe.

### How many amino acids are in cagrilintide?

Cagrilintide is made up of 37 amino acids in a single chain, the same number as the human amylin hormone it is modelled on. Both registries that list it agree on this: the FDA substance record shows a single chain of 37 amino acids, and PubChem's systematic name spells out thirty-seven amino acids ending in a proline amide. The number on the vial label is the weight in milligrams, not the amino-acid count.

### What is the amino acid sequence of cagrilintide?

The published cagrilintide sequence is KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP, 37 amino acids ending in an amide, with a sulfur-to-sulfur bridge joining the two cysteines at positions two and seven. A twenty-carbon fatty chain is attached to the first amino acid, a lysine, through a glutamate spacer. The same sequence appears in both the FDA substance registry and PubChem's systematic name, and the two were checked against each other rather than one being copied from the other.

### How does the cagrilintide sequence differ from human amylin?

Cagrilintide differs from the mature human amylin sequence published by UniProt at six positions, and four of those six swap in a proline where the natural hormone has a different amino acid. Comparing the two chains side by side, the changes are at amino acids fourteen, seventeen, twenty-five, twenty-eight, twenty-nine and thirty-seven. Everything else is the same, including the small sulfur-linked ring near the front and the amide ending.

### What is the molecular weight of cagrilintide?

PubChem gives the free cagrilintide peptide a molecular weight of about 4,409 and the formula C194H312N54O59S2, figures that apply to the free form rather than a salt. They are recorded against CID 171397054 and CAS 1415456-99-3. A salt such as the acetate weighs a different amount and has its own registry number. Australian Research Peptides does not publish which form is supplied, so the specification panel leaves out mass and CAS rather than give a figure that might not match the powder.

### Does cagrilintide have a CAS number?

Yes, the free cagrilintide peptide carries CAS 1415456-99-3 in PubChem, and it also has the identifier UNII AO43BIF1U8 from the FDA substance registry. Neither number describes a salt form, and an acetate would have its own. Australian Research Peptides gives both here rather than in the specification panel, because the panel only shows values that hold for the material supplied, and the form supplied has not been confirmed.

### What is the fatty acid chain attached to cagrilintide?

Cagrilintide carries a twenty-carbon fatty chain, attached to the front end of the peptide through a short glutamate linker rather than to a side branch further along the chain. PubChem's systematic name records it as a 19-carboxy-1-oxononadecyl group on a gamma-glutamyl unit, which is the formal way of describing the same thing. In the 2021 design paper, Kruse and colleagues call adding that chain lipidation.

### Does cagrilintide contain a disulfide bond?

Yes, cagrilintide has one disulfide bond, a link between the sulfur atoms of two cysteines, which closes a small ring between positions two and seven of the chain. PubChem writes it as a cyclic (3->8) disulfide because its numbering includes the glutamate linker, and UniProt records the matching bridge in human amylin at positions 35 and 40 of the longer parent chain. Those two cysteines are the only amino acids in the molecule that contain sulfur.

### How much peptide is in a cagrilintide vial?

Each cagrilintide vial holds ten milligrams of freeze-dried peptide, and that is the only strength Australian Research Peptides sells under this name. The amount is printed on the label. There is no second strength and nothing else in the vial, so the figure on the label is the same as the figure in the listing.

### What exactly is supplied in a cagrilintide vial?

A cagrilintide vial contains just one thing, the dried peptide itself, with no liquid, no filler powder and no second compound added. The glass is sealed with a tamper-evident closure. Nothing else is packed with it, and the batch certificate is published in the CoA library on this site.

### How many micrograms is 10 mg of cagrilintide?

Ten milligrams of cagrilintide equals ten thousand micrograms, because each milligram is a thousand micrograms, and that conversion simply describes the amount of peptide sealed in the vial. Australian Research Peptides does not publish any amount to use, so any microgram figure someone types into a search box is their own calculation for their own purposes.

### How many micromoles are in a 10 mg cagrilintide vial?

A 10 mg cagrilintide vial holds roughly 2.3 micromoles of peptide, worked out by dividing ten milligrams by the free-peptide molecular weight of about 4,409 published by PubChem. Dissolved in one millilitre, that is about 2.3 millimolar, and in two millilitres about 1.1. The figure shifts slightly if the material supplied is a salt, because the partner ion adds weight without adding peptide.

### What does cagrilintide look like in the vial?

Freeze-dried cagrilintide looks like a white to off-white solid, sometimes a firm cake at the bottom of the vial and sometimes a loose powder spread thinly up the sides. Both are normal for a freeze-dried (lyophilised) peptide, and neither says anything about the batch. Colour is what to watch: a yellow or brown tint is not what this material should look like.

### Is it normal for a cagrilintide vial to look almost empty?

Yes, it is normal for a cagrilintide vial to look almost empty, because ten milligrams of freeze-dried peptide takes up very little space and it does not mean the vial arrived short. Freeze-drying leaves a light, airy solid that can collapse into a thin film against the glass during shipping. Tilting the vial under a light and watching for material moving is a better check than judging by looking through the side.

### How should cagrilintide be stored?

Cagrilintide should be stored like other freeze-dried (lyophilised) peptides, in a tightly closed container below minus fifteen degrees Celsius, and colder for long-term storage, following Bachem's handling guidance. Bachem names asparagine, glutamine, methionine, cysteine and tryptophan as the amino acids that shorten shelf life, and cagrilintide contains three of those five. Before opening, let the container warm to room temperature in a desiccator, a sealed box that keeps moisture out.

### Which amino acids in cagrilintide shorten its shelf life?

Cagrilintide contains three of the five amino acids Bachem flags as shortening peptide shelf life: five asparagines, one glutamine and the two cysteines that form its sulfur bridge. It contains no methionine or tryptophan. This mix, read straight from the published sequence, is why the storage advice on this page calls for freezer temperatures rather than the milder conditions some very short peptides can handle.

### How do you reconstitute cagrilintide?

To reconstitute cagrilintide, meaning to dissolve the freeze-dried solid back into a liquid, work slowly and gently, which suits a long peptide that carries a fatty chain. Run the liquid down the inside wall of the vial so it wets the powder gradually instead of hitting it directly. Let the vial stand rather than shaking it, and swirl slowly if it needs help. Once the liquid is clear, divide it into single-use portions and freeze them.

### What volume of diluent goes into a 10 mg cagrilintide vial?

There is no single correct volume of diluent for a 10 mg cagrilintide vial, and Australian Research Peptides does not publish one, because the volume depends on the concentration the work needs. The maths is simple division: one millilitre gives ten milligrams per millilitre, two millilitres gives five, and five millilitres gives two.

### What is cagrilintide dissolved in for laboratory work?

Cagrilintide arrives as a dry cake and must be dissolved in a liquid before laboratory work, usually a water-based diluent or a buffer solution chosen to suit the method. No liquid is supplied inside the peptide vial itself, and the amount of liquid added sets the concentration of the finished solution.

### How long does reconstituted cagrilintide keep?

Reconstituted cagrilintide should be kept cold, at two to eight degrees Celsius, and the liquid it was mixed with often limits how long it keeps before the peptide itself does. A preserved diluent has its own use-by period from the first puncture. Bachem links asparagines and cysteines, both found in cagrilintide, with a shorter life in solution, which is why freezing single-use portions is better than piercing one vial again and again.

### Why is cagrilintide cloudy after it is mixed?

Cloudiness in freshly mixed cagrilintide is usually just air from shaking, seen as fine bubbles that collect under the stopper and clear when the vial is left to stand. Material taken straight from the freezer can also look hazy until it warms up. If the solution is still not clear after ten minutes of standing, the likely cause is undissolved solid or peptide clumping together.

### Is cagrilintide tested before it is supplied in Australia?

Yes, cagrilintide is independently lab-tested by a laboratory the manufacturer hires, not by Australian Research Peptides itself, and the testing uses mass spectrometry to measure the molecular weight. That weight check separates a 37-amino-acid chain with a fatty tail from most things it could be mistaken for. No matching certificate is currently published for this product and strength.

### What does the testing on cagrilintide prove, and what does it not?

Testing on cagrilintide confirms its weight much better than it confirms the order of its amino acids, and that limit is worth understanding before reading any certificate for this compound. Mass spectrometry confirms the molecular weight, which separates a 37-amino-acid chain with a fatty tail from most things it could be mistaken for, but the same amino acids in a different order would weigh the same. The test does not guarantee anything the certificate itself does not name.

### How does cagrilintide compare with retatrutide as a listing?

Cagrilintide and retatrutide are listed on the same Metabolic Research shelf, but chemically they share nothing beyond both being peptides with a fatty chain attached. Retatrutide is listed against a completely different set of targets and comes in three strengths, while cagrilintide is built on amylin and comes in one. Each is sold as its own single-compound vial, and this comparison is about what they are, nothing more.

### Who supplies cagrilintide in Australia?

Australian Research Peptides supplies cagrilintide in Australia, sending vials from an Australian address to laboratories and researchers in every state and territory. Parcels go by tracked post, with Express Post available when timing matters. Only one size is listed under this name, ten milligrams of freeze-dried powder, and the certificate status for it is shown in the CoA library rather than promised here.

### How much does Cagrilintide cost in Australia?

Cagrilintide costs A$189.99 for the 10 mg vial (out of stock) at Australian Research Peptides, its only strength, so there is one Australian-dollar price per vial rather than a range. It is listed as a research peptide for laboratories and researchers. Cagrilintide can leave again once restocked. Postage is charged on top, by the service chosen.

### How do I pay for a cagrilintide order?

You can pay for a cagrilintide order by PayID or bank transfer, and both are paid straight from your own bank account, so no bank login is ever entered with Australian Research Peptides. Orders paid by PayID or bank transfer are held for a set number of business days, and the exact window and reminder schedule are shown at checkout. Digital wallets, buy-now-pay-later instalments and crypto are not accepted.

### How to get cagrilintide online in Australia?

Cagrilintide is ordered online from Australian Research Peptides by adding the 10 mg vial to the cart on this page and checking out with an Australian delivery address. Payment is by PayID or bank transfer, and the vial is posted from stock held in Australia, so the parcel never passes through customs. It is supplied to laboratories and researchers.

### How long does cagrilintide take to arrive in Australia?

Cagrilintide usually takes two to five business days to arrive by standard tracked post, or one to two business days by Express Post to most of Australia. Western Australia and the Northern Territory take two to four days even by Express. These times count from when the parcel is lodged with the post, not when the order is placed, and the tracking number emailed at that point is where any delivery query starts.

### How will I know when cagrilintide is back in stock?

To hear when cagrilintide is back in stock, leave your email for a stock alert on this page, which sends one email only and keeps your address only until that email is sent. There is no mailing list to leave and no second email. To be told again, you need to sign up again, which matters for a product whose stock can change more than once a year.

### Does a cagrilintide vial come with a diluent?

No, a cagrilintide vial does not come with a diluent, because the 10 mg vial holds only the dried peptide and the laboratory chooses the liquid to suit its own method. The laboratory also chooses how to handle the solution, and the vial is normally dissolved once, in a single step.

### Is cagrilintide approved in Australia?

No, cagrilintide is not approved for therapeutic use by the TGA, and no approved medicine containing it is available in Australia. Australian Research Peptides sells the 10 mg vial as a laboratory reference compound, with no medical claim of any kind attached. The TGA publishes its own guidance on unapproved peptide products, and its register can be searched for a definitive answer.

### Can you legally import cagrilintide into Australia?

Cagrilintide is not an approved medicine in Australia, so whether it can be legally imported is governed by the TGA's rules for unapproved goods rather than those for a registered product. The TGA publishes guidance that covers peptides specifically. An order placed with Australian Research Peptides is sent from within Australia, so it involves no import step at all.

### Can I buy cagrilintide at a pharmacy in Australia?

No, you cannot buy cagrilintide at an Australian pharmacy, because a pharmacy needs a registered product to dispense and nothing under this name is registered in Australia. That applies to the big chains and independent pharmacies alike, with no approved version for any of them to order in. Australian Research Peptides sells it as a 10 mg research vial for laboratory work, which is a different channel serving a different purpose.

### Is cagrilintide banned in sport?

Cagrilintide's status in sport is a question for [Sport Integrity Australia](https://www.sportintegrity.gov.au/what-we-do/anti-doping/prohibited-substances-and-methods/prohibited-list-explained), whose Prohibited List explainer describes a category, S0, that bans at all times any substance no government health regulator anywhere has approved for human therapeutic use. Australian Research Peptides publishes no anti-doping status for this product and has no standing to clear anything for a tested athlete.

### What does Australian Research Peptides claim about cagrilintide?

Australian Research Peptides states what cagrilintide is, how much is in the vial, how it should be stored and what its batch testing covers, and nothing more. No outcome, benefit, result or comparison of effect is claimed anywhere on this page. The material is sold to laboratories and researchers for in vitro work only, meaning in glassware and cell culture rather than a living subject, and it is not offered for use in people or animals.

## Ordering

- Standard post $12.99, free on orders over $199.00
- Express post $16.99, free on orders over $299.00
- Payment: PayID or bank transfer
- Dispatched from within Australia; orders do not cross a border

---

Product page: https://www.australianresearchpeptides.au/products/cagrilintide
Shop: https://www.australianresearchpeptides.au/shop